산출물 관리

15 Jan 18
 

Tau-pre8

12 Sep 16
doi:10.20927/presmo.112508 Tau-pre8 Poly-proline II Helix 232-239 Microtubule binding(214-241) Human (Alzheimer) 2009 M. Zweckstetter null Tau http://www.doi.or.kr/wordpress/?p=1723 441 MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQxPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPExTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTxIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSxGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPxPDLKN doi:10.1371/journal.pbio.1000034Structural Polymorphism of 441-Residue Tau at Single Residue ResolutionMarco D Mukrasch, Stefan Bibow, ...

Tau-pre7

12 Sep 16
doi:10.20927/presmo.112507 Tau-pre7 Poly-proline II Helix 216-223 Microtubule binding(214-241) Human (Alzheimer) 2009 M. Zweckstetter null Tau http://www.doi.or.kr/wordpress/?p=1722 441 MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQxPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPExTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTxIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSxGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPxPDLKN doi:10.1371/journal.pbio.1000034Structural Polymorphism of 441-Residue Tau at Single Residue ResolutionMarco D Mukrasch, Stefan Bibow, ...

Tau-pre6

12 Sep 16
doi:10.20927/presmo.112506 Tau-pre6 Poly-proline II Helix 175-184 null Human (Alzheimer) 2009 M. Zweckstetter null Tau http://www.doi.or.kr/wordpress/?p=1721 441 MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQxPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPExTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTxIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSxGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPxPDLKN doi:10.1371/journal.pbio.1000034Structural Polymorphism of 441-Residue Tau at Single Residue ResolutionMarco D Mukrasch, Stefan Bibow, Jegannath ...

Tau-pre5

12 Sep 16
doi:10.20927/presmo.112505 Tau-pre5 β Sheet 336-345 null Human (Alzheimer) 2009 M. Zweckstetter null Tau http://www.doi.or.kr/wordpress/?p=1720 441 MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQxPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPExTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTxIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSxGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPxPDLKN doi:10.1371/journal.pbio.1000034Structural Polymorphism of 441-Residue Tau at Single Residue ResolutionMarco D Mukrasch, Stefan Bibow, Jegannath ...

Tau-pre4

12 Sep 16
doi:10.20927/presmo.112504 Tau-pre4 β Sheet 305-315 Microtubule binding(278-309) Human (Alzheimer) 2009 M. Zweckstetter null Tau http://www.doi.or.kr/wordpress/?p=1719 441 MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQxPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPExTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTxIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSxGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPxPDLKN doi:10.1371/journal.pbio.1000034Structural Polymorphism of 441-Residue Tau at Single Residue ResolutionMarco D Mukrasch, Stefan Bibow, ...

Tau-pre3

12 Sep 16
doi:10.20927/presmo.112503 Tau-pre3 β Sheet 274-284 Microtubule binding(278-309) Human (Alzheimer) 2009 M. Zweckstetter null Tau http://www.doi.or.kr/wordpress/?p=1718 441 MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQxPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPExTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTxIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSxGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPxPDLKN doi:10.1371/journal.pbio.1000034Structural Polymorphism of 441-Residue Tau at Single Residue ResolutionMarco D Mukrasch, Stefan Bibow, ...

Tau-pre2

12 Sep 16
doi:10.20927/presmo.112502 Tau-pre2 α Helix 428-437 null Human (Alzheimer) 2009 M. Zweckstetter null Tau http://www.doi.or.kr/wordpress/?p=1717 441 MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQxPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPExTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTxIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSxGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPxPDLKN doi:10.1371/journal.pbio.1000034Structural Polymorphism of 441-Residue Tau at Single Residue ResolutionMarco D Mukrasch, Stefan Bibow, Jegannath Korukottu, ...

Tau-pre1

12 Sep 16
doi:10.20927/presmo.112501 Tau-pre1 α Helix 114-123 null Human (Alzheimer) 2009 M. Zweckstetter null Tau http://www.doi.or.kr/wordpress/?p=1716 441 MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQxPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPExTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTxIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSxGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPxPDLKN doi:10.1371/journal.pbio.1000034Structural Polymorphism of 441-Residue Tau at Single Residue ResolutionMarco D Mukrasch, Stefan Bibow, Jegannath Korukottu, ...

preS1 of HBV-pre6

12 Sep 16
doi:10.20927/presmo.112406 preS1 of HBV-pre6 α Helix 46-50 Hepatocyte receptor binding Hepatitis B Virus 2007 Kyou-Hoon Han null preS1 of HBV http://www.doi.or.kr/wordpress/?p=1715 119 Met1Gly2Gly2Trp4Ser5Ser6Lys7Pro8Arg9Gln10Gly11Met12Gly13Thr14Asn15Leu16Ser17Val18Pro19Asn20Pro21Leu22Gly23Phe24Phe25Pro26Asp27His28Gln29Leu30Asp31Pro32Ala33Phe34Gly35Ala36Asn37Ser38Asn39Asn40Pro41Asp42Trp43Asp44Phe45Asn46Pro47Asn48Lys49Asp50His51Trp52Pro5 doi:10.1110/ps.072983507Pre-structured motifs in the natively unstructured preS1 surface ...