[PreSMo_doi]
doi:10.20927/presmo.112501
[PreSMo_Name]
Tau-pre1
[PreSMo_Residues]
α Helix 114-123
[Role]
null
[Species]
Human (Alzheimer)
[YearFound_Released]
2009
[Reporter]
M. Zweckstetter
[Description]
null
[IDP_Name]
Tau
[Link]
http://www.doi.or.kr/wordpress/?p=1716
[Residue_count]
441
[Amino_Seq]
MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQxPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPExTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTxIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSxGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPxPDLKN
[Reference]
doi:10.1371/journal.pbio.1000034
Structural Polymorphism of 441-Residue Tau at Single Residue Resolution

Marco D Mukrasch, Stefan Bibow, Jegannath Korukottu, Sadasivam Jeganathan, Jacek Biernat, Christian Griesinger, Eckhard Mandelkow, Markus Zweckstetter

Alzheimer disease is characterized by abnormal protein deposits in the brain, such as extracellular amyloid plaques and intracellular neurofibrillary tangles. The tangles are made of a protein called tau comprising 441 residues in its longest isoform. Tau belongs to the class of natively unfolded proteins, binds to and stabilizes microtubules, and partially folds into an ordered β-structure during aggregation to Alzheimer paired helical filaments (PHFs). Here we show that it is possible to overcome the size limitations that have traditionally hampered detailed nuclear magnetic resonance (NMR) spectroscopy studies of such large nonglobular proteins. This is achieved using optimal NMR pulse sequences and matching of chemical shifts from smaller segments in a divide and conquer strategy. The methodology reveals that 441-residue tau is highly dynamic in solution with a distinct domain character and an intricate network of transient long-range contacts important for pathogenic aggregation. Moreover, the single-residue view provided by the NMR analysis reveals unique insights into the interaction of tau with microtubules. Our results establish that NMR spectroscopy can provide detailed insight into the structural polymorphism of very large nonglobular proteins.


[Structure]